PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG025007.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 604aa    MW: 68606.3 Da    PI: 6.0908
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG025007.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3521.53.4e-159364131353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+m+lkrlke++k+    ke  ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  CCG025007.2  36 DELERRMWRDKMRLKRLKEQTKS----KEG-IDIAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 128
                  79*******************98....788.******************************************************************* PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww++lgl+kd+g+ppyk
  CCG025007.2 129 VRFDRNGPAAIAKYQADNSIPGKDEGCNS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPSGNEEWWPQLGLPKDHGPPPYK 225
                  ***************************88.9******************************************************************* PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedvegkkesk 291
                  kphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++s    s++ +s ++++++++++dveg +++ 
  CCG025007.2 226 KPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPNSCpplSSSGGSGSLVINDSSEYDVEGAEDEP 323
                  *******************************************************************444466677****************777666 PP

                  .XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                    + q++k ++                              +++++rkrk ++s+ +++ +++ ++tc+  q+ +s+ +l+f+d+ +++ ++
  CCG025007.2 324 NFDLQECKPETlsysnlgmermgerlplrqqpypikgevmtSTDFIRKRK-PSSDINMMVDQK-IYTCEAVQCAHSQIRLGFPDRAARDTHQ 413
                  699*****999******************************9*******9.667767776675.5************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.9E-13136283No hitNo description
Gene3DG3DSA:1.10.3180.102.4E-76156293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167685.23E-62162286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MDFFCTPLVE GDVSAPQVEP EVTVEDDYSD EEIDVDELER RMWRDKMRLK RLKEQTKSKE  60
GIDIAKQRQS QEQARRKKMS RAQDGILKYM LKMMEVCKAQ GFVYGIIPEK GKPVTGASDN  120
LREWWKDKVR FDRNGPAAIA KYQADNSIPG KDEGCNSIGP TPHTLQELQD TTLGSLLSAL  180
MQHCDPPQRR FPLEKGVPPP WWPSGNEEWW PQLGLPKDHG PPPYKKPHDL KKAWKVGVLT  240
AVIKHMSPDI AKIRKLVRQS KCLQDKMTAK ESATWLAIIN QEESLARELY PNSCPPLSSS  300
GGSGSLVIND SSEYDVEGAE DEPNFDLQEC KPETLSYSNL GMERMGERLP LRQQPYPIKG  360
EVMTSTDFIR KRKPSSDINM MVDQKIYTCE AVQCAHSQIR LGFPDRAARD THQLNCPYRS  420
TSLEFRGSNF HVNEIKPVIY PQPSAQSKTT APLGNPAPSS FNLSGVPEDG QKMISELMSI  480
YDTNIQGNKN TNRGNNLVTE DHNVFQPKIQ HQQDNHFRGQ SNMINGNIFE ESNINQNHQM  540
FSQEVGQFDR FKPLNSPFET NQNNSGFSLM FGSPFDLSSF DYKDDLQVLG MDTLPKHQDV  600
STWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-861612932134Protein ETHYLENE INSENSITIVE 3
4zds_B4e-861612932134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006497.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_011006504.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLB9MYS90.0B9MYS9_POPTR; EIN3-like family protein
STRINGPOPTR_0004s20830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein